HORDB

ID: hor006118
Uniprot ID: P13208
Protein name: Sarafotoxin-C
Gene name: NA
Organism: Atractaspis engaddensis (Israeli burrowing asp) (Israeli mole viper)
Family: Endothelin/sarafotoxin family
Source: animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Atractaspis (genus), Atractaspidinae (subfamily), Lamprophiidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0090729 toxin activity
GO BP: GO:0019229 regulation of vasoconstriction; GO:0035821 modulation of process of another organism; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: CTCNDMTDEECLNFCHQDVIW
Length: 21
Propeptide: MALLPRLAAGGLLLLLALAALEGKPAPSALSQLLEKRSEDQAAAGRIIDGGDTKQAARDPSPQRNVEPLCSCKDMSDKECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKECLYFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCKDMTDKECLYFCHQGIIWRDTKQAARDPSPQRNVEPLCSCKDMSDKECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKECLYFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMSDKECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKECLNFCHQDVIWKNADTSANPEFLG
Signal peptide: MALLPRLAAGGLLLLLALAALEG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Vasoconstrictor activity. These toxins cause cardiac arrest probably as a result of coronary vasospasm.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006118_AF2.pdb

hor006118_ESM.pdb

Mass:	287674	Formula:	C103H151N27O37S5
Absent amino acids:	AGKPRSY	Common amino acids:	C
pI:	3.61	Basic residues:	1
Polar residues:	8	Hydrophobic residues:	5
Hydrophobicity:	-30	Boman Index:	-4174
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	50.95
Instability Index:	8683.33	Extinction Coefficient cystines:	5750
Absorbance 280nm:	287.5

PubMed ID: 8428983
Title: Cloning and sequence analysis of cDNAs encoding precursors of sarafotoxins. Evidence for an unusual "rosary-type" organization.
PubMed ID: 3176048
Title: Sarafotoxins S6: several isotoxins from Atractaspis engaddensis (burrowing asp) venom that affect the heart.
PubMed ID: 2845579
Title: Sarafotoxin, a novel vasoconstrictor peptide: phosphoinositide hydrolysis in rat heart and brain.
PubMed ID: 1339278
Title: Cloning and sequence analysis of a snake, Atractaspis engaddensis gene encoding sarafotoxin S6c.
PubMed ID: 2080919
Title: Studies on the disulfide bridges of sarafotoxins. Chemical synthesis of sarafotoxin S6B and its homologue with different disulfide bridges.
PubMed ID: 21889567
Title: Pharmacological and structural characterization of long-sarafotoxins, a new family of endothelin-like peptides: Role of the C-terminus extension.
PubMed ID: 2037041
Title: Conformation of sarafotoxin-6b in aqueous solution determined by NMR spectroscopy and distance geometry.
PubMed ID: 20504727
Title: (1)H NMR Study of the solution structure of sarafotoxin-S6b.
PubMed ID: 7849060
Title: 1H NMR studies of sarafotoxin SRTb, a nonselective endothelin receptor agonist, and IRL 1620, an ETB receptor-specific agonist.